Methyl CpG Binding Protein 2 Human Recombinant ( MECP2 Human )

Data sheet

Reconstitution

1mg/ml in PBS (after reconstitution).

Formulation

The MECP2 solution (0.45mg/ml) contains 50mM Tris, 135mM NaCl, 20% Glycerol, pH 7.5 and 200ug/ml FLAG peptide.

Solubility

This antibody will bind very well to protein A in a buffer (PBS) containing high salt concentration (3M Nacl).

Purity

Greater than 80% as determined by SDS-PAGE.

Description

MECP2 Human Recombinant is expressed in 293 cells. The protein contains 486 amino acids (1-486a.a.) and fused to an N-terminal Flag tag, having an Mw of 53.56kDa.

Protein Background

MECP2 is the key modificator of eukaryotic genomes and has a crucial part in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 form a family of nuclear proteins linked by the existence in each of a methyl-CpG binding domain (MBD). Ea

Expression host

Mammalian system, 293 cells.

Synonyms

Methyl CpG binding protein 2 (Rett syndrome), MeCp-2 protein, AUTSX3, MRX16, MRX79, MRXS13, MRXSL, PPMX, RTT, Mental retardation, X-linked 16, DKFZp686A24160.

Reagent Appearance

Sterile Filtered colorless solution.

Stability

MECP2 although stable 4°C for 4 weeks, should be stored below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Amino acid sequence

MDYKDDDDKMVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVM

Antibody Properties

Reconstitute with sterile H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.

Titer

Antibody is shipped lyophilized at ambient temperature.

Protein content

In direct ELISA, using alkaline phosphatase goat anti-mouse Ig (Jackson Laboratories) 1:10,000 dilution will yield 0.5 O.D within 10 minutes.