Myelin Oligodendrocyte Glycoprotein Human Recombinant ( MOG Human )

Data sheet

Formulation

The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.

Solubility

It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Purity

Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Description

Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.

Protein Background

Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination.

Expression host

Escherichia Coli.

Synonyms

Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.

Reagent Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Stability

Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carr

Amino acid sequence

MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH.