Helicobacter Pylori Outer Membrane Protein Recombinant ( Omp Pylori )

Catalog # PT_41654

Print

$315.00
DescriptionOmp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected
Product Size: 100ug
Quantity

Data sheet

Formulation
The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.
Purity
Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Description
Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.
Protein Background
Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal a
Expression host
E.Coli
Reagent Appearance
Sterile filtered liquid formulation.
Stability
Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Amino acid sequence
MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.
Purification Method
Purified by proprietary chromatographic technique.
Recommendations on use
PKC-a is supplied in 20mM HEPES pH 7.5, 250mM NaCl, 50% glycerol, 2mM EDTA, 2mM EGTA, 0.05%Triton X-100 and 5mM DTT.
AA Sequence
10mM HEPES (pH7.4), 0.01% CHAPS and 5mM DTT.*for further dilution you may use either the Storage Buffer or Dilution Buffer.
New