Syndecan-4 Human Recombinant, His Tag ( SDC4 Human, His )

Data sheet

Formulation

The SDC4 (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4.

Solubility

It is recommended to reconstitute the lyophilized SDC4 in sterile 18M-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

Purity

Greater than 95.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Description

Syndecan-4 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 140 amino acids and having a molecular mass of 15.4 kDa.The SDC4 is purified by proprietary chromatographic techniques.

Protein Background

Syndecan-4 is a type I integral membrane heparan sulfate proteoglycan (HSPG), which was originally isolated from cloned rat microvascular endothelial cells as an antithrombin-binding molecule, and is now known to be a member of the syndecan family. Syndec

Expression host

Escherichia Coli.

Synonyms

SDC4, SYND4, SYND-4, Amphiglycan, Ryudocan core protein, Syndecan-4.

Reagent Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Stability

Lyophilized SDC4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SDC4 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a c

Amino acid sequence

MASIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLALEHHHHHH.