Streptavidin Recombinant ( Streptavidin )

Data sheet

Formulation

Lyophilized (1mg/ml) in 50mM NaCl, pH 9.0.

Solubility

Gives a clear solution at 5mg/ml in 0.1M NaCl.

Purity

Greater than 98.0% as determined by SDS-PAGE and HPLC.

Description

Streptavidin is a protein produced by Streptomyces avidinii and isolated by purification from fermentation broth. The pure, homogeneous protein shows predominantly one single band in SDS PAGE. Streptavidin consists of 4 identical subunits, each bearing an

Protein Background

Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is wilyde used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-str

Expression host

Bacterium Streptomyces avidinii.

Reagent Appearance

Sterile Filtered lyophilized powder.

Stability

Streptavidin although stable at 4°C for 3 weeks, should be stored desiccated below -18°C. For longer storage in dissolved form add 1mM EDTA and/or 0.02 % NaN3 or pass the solution through a sterile filter.Please prevent freeze-thaw cycles.

Amino acid sequence

MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.

Specific Activity

Greater than 19.5U/mg, 1 unit binds 1ug biotin.