VEGF (121 a.a.) Human, Sf9

Data sheet

Formulation

The protein was lyophilized from a solution containing 50mM acetic acid.

Solubility

The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50ug/ml.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Description

Vascular Endothelial Growth Factor-121 Human Recombinant produced in insect cells as an 18kDa homodimer, is a glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of approximately 36kDa.VEGF121 circulates more freely than

Protein Background

Vascular endothelial growth factor is an important signaling protein involved in both vasculogenesis and angiogenesis. As its name implies, VEGF activity has been mostly studied on cells of the vascular endothelium, although it does have effects on a numb

Expression host

Sf9, Insect Cells.

Synonyms

Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.

Reagent Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Stability

Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term

Amino acid sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR.

Biological Activity

Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml.

Antibody Properties

Reconstitute with sterile H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.

Titer

Antibody is shipped lyophilized at ambient temperature.

Protein content

By direct ELISA, 1:10,000 dilution will yield 0.4 O.D using alkaline phosphatase conjugated rabbit anti-mouse Ig (Jackson Laboratories).