Chitodextrinase Clostridium Botulinum Recombinant ( Chitodextrinase )

Data sheet

Formulation

Chitodextrinase lyophilized from a 0.2um filtered concentrated solution in PBS.

Solubility

It is recommended to reconstitute the lyophilized Chitodextrinase in sterile 18M?-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Description

Chitodextrinase Clostridium Botulinum Recombinant fused with a 13 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 590 amino acids and having a molecular mass of 66.9kDa. The Chitodextrinase i

Protein Background

Chitodextrinase is a unique membrane-bound endoenzyme. The chitodextrinase enzyme cleaves soluble oligomers, but not chitin, to the di- and trisaccharides. Chitodextrinase is unable to solubilize chitin, but it can catalyze the hydrolysis of high to low m

Expression host

Escherichia Coli.

Reagent Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Stability

Lyophilized Chitodextrinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Chitodextrinase should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is r

Amino acid sequence

HMRGSGSHHHHHHKEKFKTTKIKNSSELNRKLVGYFPEWAYSSEAQGYFNVTDLQWDSLTHIQYSFAMVDPSTNKITLSNKHAAIEEDFSEFDLNYNGKKIELDPSLPYKGHFNVLQTMKKNYPDVSLLISVGGWTGTRCFYTMIDTDNRINTFADSCVDFIRKYGFDGVDIDFEYPSSTSQSGNPDDFDLSEPRRTKLNERYNILIKTLREKIDMASKEDGKEYLLTAAVTASPWVLGGISDNTYAKYLDFLSI