Macrophage Migration Inhibitory Factor Human Recombinant ( Active ) ( MIF Human, Active )

Data sheet

Formulation

MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.

Solubility

It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18M-cm H2O at a concentration between 0.1mg-1mg per 1ml.

Purity

Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Description

MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain

Protein Background

The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophage

Expression host

Escherichia Coli.

Synonyms

Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.

Reagent Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Stability

Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommend

Amino acid sequence

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA.

Biological Activity

Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.