Hepatitis B Surface Antigen, preS1 Recombinant ( HBsAg preS1 )

Data sheet

Storage

This lyophilized HBsAg preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted

Formulation

HBsAg protein was lyophilized from 0.2m filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl.

Solubility

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportion

Purity

HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining).

Description

The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa.

Protein Background

Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. L

Expression host

Escherichia Coli.

Amino acid sequence

MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.

Purification Method

HBsAg protein was purified by proprietary chromatographic technique.