HIV-1 gp41 Long Recombinant ( HIV-1 gp41 Long )

Catalog # PT_40976

Print

$315.00
DescriptionThe E.Coli derived protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41 288 amino acids (466-753) immunodominant regions gp41L. The protein is fused to b-galactosidase (114 kDa) at N-Terminus.SourceEscherichia
Product Size: 100ug
Quantity

Data sheet

Formulation
8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.
Purity
Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.
Description
The E.Coli derived protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41 395 amino acids (444-833) immunodominant regions gp41L. The protein is fused to b-galactosidase (114 kDa) at N-Terminus.
Protein Background
Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD
Expression host
Escherichia Coli.
Reagent Appearance
Sterile filtered colorless clear solution.
Stability
HIV-1 gp41 Long although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Stability/Storage
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Patent Rights
Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended.
New