Recombinant Human Papillomavirus 18 ( HPV 18 )

Catalog # PT_41045

Print

$315.00
DescriptionThe Recombinant HPV-18 (a 56kDa antigen) comprised from the E2, E6 & E7 epitopes is expressed in E. coli and fused to a GST-Tag, having a total Mw of 83kDa, purified by standard chromatography.SourceE.ColiPurification MethodThe
Product Size: 100ug
Quantity

Data sheet

Formulation
Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Purity
Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Description
The Recombinant HPV-18 is a full length large capsid protein having a Mw of 56kDa expressed in E. coli and fused to a GST-Tag, having a total Mw of 83kDa, purified by standard chromatography.
Protein Background
Human papillomavirus family consist of over 200 types. Over than 30 to 40 types of HPV are transferred via sexual contact and infect the anogenital region initiating genital warts. Persistent infection with "high-risk" HPV types results in skin warts and
Expression host
E.Coli
Synonyms
Papillomavirus, HPV, Papilloma Virus.
Amino acid sequence
VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNR
Purification Method
The recombinant HPV-16 fusion protein was purified by GSH affinity chromatography technique.
Physical Appearence
Sterile filtered clear liquid formulation.
New