Hepatocyte Growth Factor A Chain Human Recombinant ( HGF A Human )

Data sheet

Formulation

HGF-A protein is supplied in 25mM Na. Acetate pH4.8, 1mM EDTA and 50% glycerol.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Description

HGF-A Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 463 amino acids fragment (32-494) having a total molecular weight of 57.8kDa. The HGF-A is fused with a 4.5kDa amino-terminal hexahistidine tag.The HGF-

Protein Background

Hepatocyte Growth Factor (HGF) is a multifunctional growth factor which regulates both cell growth and cell motility. It exerts a strong mitogenic effect on hepatocytes and primary epithelial cells. HGF synergizes with Interleukin-3 and GM-CSF to stimulat

Expression host

Escherichia Coli.

Synonyms

Scatter Factor, SF, Hepatopoietin, HPTA, HGF, HGFB, F-TCF, DFNB39, Hepatocyte growth factor, Hepatopoeitin-A, Hepatocyte growth factor alpha chain.

Reagent Appearance

Sterile Filtered clear solution.

Stability

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.

Amino acid sequence

QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIK