Hepatocyte Growth Factor Human Recombinant ( HGF Human )

Data sheet

Formulation

The sterile protein powder (1 mg/ml) is lyophilized from a solution containing 50mM acetic acid.

Solubility

It is recommended to reconstitute the lyophilized Hepatocyte Growth Factor in 50mM acetic acid to a concentration not less than 100ug/ml. Further dilutions should be made using buffer containing protein.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Description

Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa.The HGF is purified by proprietary chromatographic techniques.

Protein Background

Hepatocyte Growth Factor (HGF) is a multifunctional growth factor which regulates both cell growth and cell motility. It exerts a strong mitogenic effect on hepatocytes and primary epithelial cells. HGF synergizes with Interleukin-3 and GM-CSF to stimulat

Expression host

Insect cells.

Synonyms

Scatter Factor (SF), Hepatopoietin (HPTA), HGF, HGFB, F-TCF.

Reagent Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Stability

Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HGF should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is rec

Amino acid sequence

QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADN

Biological Activity

The activity was assayed for scattering activity in the MDCK cell assay. The ED50 for this effect is typically at 1.0-5.0 ng/ml (200,000-1,000,000 IU/mg).