MHC Class-I chain related gene A Human Recombinant ( MICA Human )

Catalog # PT_41516

Print

$201.00
DescriptionMICA Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa. The sequence contains the full length extracellular domain of the mature human MICA
Product Size: 2ug
Quantity

Data sheet

Formulation
Lyophilized from a concentrated (1mg/ml) solution containing no additives.
Solubility
It is recommended to reconstitute the lyophilized MICA in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Purity
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Description
MICA Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa. The sequence contains the full length extracellular domain of the mature human MICA (amino acid resi
Protein Background
MICA (MHC class I chain-related gene A) is a transmembrane glycoprotein that functions as a ligand for human NKG2D. A closely related protein, MICB, shares 85% amino acid identity with MICA. These proteins are distantly related to the MHC class I proteins
Expression host
Escherichia Coli.
Synonyms
MHC class I polypeptide-related sequence A, MIC-A, MICA, PERB11.1, HLA-B, AS, HLAB, HLAC, SPDA1, HLA-B73, HLA-B-7301.
Reagent Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Stability
Lyophilized MICA although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MICA should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a ca
Amino acid sequence
EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQ
Biological Activity
Measured by its ability to bind MICA antibody in ELISA.
References
1.Title:Therapy-induced antibodies to MHC class I chain-related protein A antagonize immune suppression and stimulate antitumor cytotoxicity.Publication:PNAS  June 13, 2006  vol. 103  no. 24  9191Link:http://www.pnas.org/content/103/24/9190.full.pdf2.
New