RAR-Related Orphan Receptor C Human Recombinant ( RORC Human )

Data sheet

Formulation

RORC protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5.

Purity

Greater than 80.0% as determined by SDS-PAGE.

Description

RAR-Related Orphan Receptor C Human Recombinant produced in E.Coli is a full length protein consisting of 497 amino acids having a molecular weight of 55.8kDa and fused with 5.5kDa amino-terminal His-Flag tag.RORC is purified by proprietary chromatographi

Protein Background

RORC is a DNA-binding transcription factor which belongs to the NR1 subfamily of nuclear hormone receptors. The specific functions of the RORC protein are not known; nevertheless, studies of a similar gene in mice have shown that the RORC gene may be vita

Expression host

Escherichia Coli.

Synonyms

Nuclear receptor ROR-gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, Retinoid-related orphan receptor-gamma, RORC, NR1F3, RORG, RZRG, TOR, RZR-GAMMA.

Reagent Appearance

Sterile filtered colorless solution.

Stability

Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles.

Amino acid sequence

MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYFQGEFMRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFE