Vascular Cell Adhesion Molecule 1 Rabbit Recombinant ( VCAM1 Rabbit )

Catalog # PT_71910

Print

$201.00
DescriptionVCAM1 Rabbit Recombinant is expressed in insect cells and containing 674 amino acids (a.a. 25-698) fused to a N-terminal hexahistidine tag, having a total MW of 77.06kDa.SourceBaculovirus sytem, insect cells.Physical AppearanceSterile
Product Size: 2ug
Quantity

Data sheet

Formulation
The VCAM1 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
Purity
Greater than 90% as determined by SDS-PAGE.
Description
VCAM1 Rabbit Recombinant is expressed in insect cells and containing 674 amino acids (a.a. 25-698) fused to a N-terminal hexahistidine tag, having a total MW of 77.06kDa.
Protein Background
VCAM1 is a member of the Ig superfamily. It is a cell surface sialoglycoprotein expressed by cytokine activated endothelium. VCAM-1 contains 6 or 7 immunoglobulin domains, and is expressed on both large and small vessels only after the endothelial cells a
Expression host
Baculovirus sytem, insect cells.
Synonyms
Vascular cell adhesion protein 1, V-CAM 1, INCAM-100, CD106, VCAM1, L1CAM, MGC99561, DKFZp779G2333.
Reagent Appearance
Sterile Filtered colorless solution.
Stability
VCAM1 although stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Amino acid sequence
AFKIETFPESRSLAQIGDSVSLTCTTTGCASPTFSWRTQIDSPLNGKVRSEGTTSTLTMDPVSFENEHSYLCTATCESKKLEKGIQVEIYSFPKDPEIHLSGPLEVGEPITVKCLVPDVYPFDRLEVDLLKGDYLMKKQDFLEDMDRKSLETKSLEVTFIPVIEDIGKLIVCRAKLHIDEIDSEPKERETTKELQVYISPKNTVISVNPSTRLQEGGSVTMTCSSEGLPVPEIFWSKKQDNGNLQRLSGNATLTL
New