CHIKV Mutant

Data sheet

Formulation

CHIKV Mutant protein solution in 1xD-PBS, pH7.4, 0.1% Thimerosal, 5mM EDTA, 1ug/ml of Leupeptin, Aprotinin and Pepstatin A.

Purity

Protein is >95% pure as determined by 12.5% SDS-PAGE.

Description

Recombinant Chikungunya Mutant (A226V) E1 produced in Insect Cells is a polypeptide chain containing amino acids 1-415, however at position 226 the Alanine of the wild-type CHIKV E1 gene was mutated to Valine. The molecular weight of the CHIKV Mutant is a

Protein Background

Chikungunya virus (CHIKV) is an arthropod-born virus which is a member of the Alphavirus genus belonging to the Togaviridae family. CHIKV nucleocapsid is comprised of a single-stranded plussense RNA genome of approximately 11.8 kb. The CHIKV virion envelo

Expression host

Insect cells.

Reagent Appearance

Sterile filtered colorless solution.

Stability

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

Amino acid sequence

YEHVTVIPNTVGVPYKTLVNRPGYSPMVLEMELLSVTLEPTLSLDYITCEYKTVIPSPYVKCCGTAECKDKNLPDYSCKVFTGVYPFMWGGAYCFCDAENTQLSEAHVEKSESCKTEFASAYRAHTASASAKLRVLYQGNNITVTAYANGDHAVTVKDAKFIVGPMSSAWTPFDNKIVVYKGDVYNMDYPPFGAGRPGQFGDIQSRTPESKDVYANTQLVLQRPAVGTVHVPYSQAPSGFKYWLKERGASLQHTA