CD14 Human HEK

Data sheet

Formulation

CD14 was lyophilized from a 0.2 uM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.

Solubility

It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

Purity

Greater than 95% as determined by SDS-PAGE.

Description

CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Protein Background

CD14 (also known lipopolysaccharide (LPS) receptor) is expressed strongly on monocytes and macrophage and weakly on the surface of neutrophils. CD14 is anchored to cells by linkage to glycosylphosphatidylinositol (GPI) and functions as a high affinity rec

Expression host

HEK293 cells.

Synonyms

Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14.

Reagent Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Stability

Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Amino acid sequence

TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMW