Granulysin Human Recombinant ( GNLY Human ) (PT_40723)
search
  • Granulysin Human Recombinant ( GNLY Human ) (PT_40723)

Granulysin Human Recombinant ( GNLY Human )

Catalog # PT_40723

Print

$201.00
DescriptionGNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by
Product Size: 2ug
Quantity

Sold only to research institutions and qualified laboratory professionals. Not for sale to individuals for personal use.

GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.

  • Expression host: Escherichia Coli.
  • Purity: Greater than 95.0% as determined by SDS-PAGE.
  • Formulation: The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
  • Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
  • Stability: Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is ...

Catalog number PT_40723. Available sizes: 2 ug, 10 ug, 1 mg. Order online or request a quote. For research use only. Not for diagnostic or therapeutic use, and not for human or animal consumption.

Data sheet

Formulation
The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Solubility
It is recommended to reconstitute the lyophilized Granulysin in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Description
GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by proprietary chromatogr
Protein Background
GNLY is part of the SAPLIP family and is located in the cytotoxic granules of T cells, which are discharged upon antigen stimulation. GNLY is localized in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial act
Expression host
Escherichia Coli.
Synonyms
LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E.
Reagent Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Stability
Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommende
Amino acid sequence
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH.
New