Interleukin-6 Recombinant Human, CHO ( IL 6 Human, CHO ) (PT_73429)
search
  • Interleukin-6 Recombinant Human, CHO ( IL 6 Human, CHO ) (PT_73429)

Interleukin-6 Recombinant Human, CHO ( IL 6 Human, CHO )

Catalog # PT_73429

Print

$201.00
DescriptionInterleukin-6 Human Recombinant produced in CHO is a single, glycosylated polypeptide chain containing 185 amino acids and migrates at 22 kDa as a glycosilated protein on SDS-PAGE.The IL6 is purified by proprietary chromatographic
Product Size: 5ug
Quantity

Sold only to research institutions and qualified laboratory professionals. Not for sale to individuals for personal use.

Interleukin-6 Human Recombinant produced in CHO is a 21-23kDa single, glycosylated polypeptide chain containing 183 amino acids.

  • Expression host: Chinese Hamster Ovarian Cells.
  • Purity: Greater than 95.0% as determined by analysis by SDS-PAGE.
  • Biological activity: ED50
  • Formulation: IL-6 is a sterile filtered (0.22um) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2.
  • Appearance: Sterile filtered colorless solution.
  • Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

Catalog number PT_73429. Available sizes: 5 ug, 20 ug, 1 mg. Order online or request a quote. For research use only. Not for diagnostic or therapeutic use, and not for human or animal consumption.

Data sheet

Formulation
IL-6 is a sterile filtered (0.22um) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2.
Purity
Greater than 95.0% as determined by analysis by SDS-PAGE.
Description
Interleukin-6 Human Recombinant produced in CHO is a 21-23kDa single, glycosylated polypeptide chain containing 183 amino acids.
Protein Background
IL-6 is a cytokine with a wide variety of biological functions: it plays an essential role in the final differentiation of b-cells into ig-secreting cells, it induces myeloma and plasmacytoma growth, it induces nerve cells differentiation, in hepatocytes
Expression host
Chinese Hamster Ovarian Cells.
Synonyms
IFN-b2, B cell differentiation factor, BCDF, BSF-2, HPGF, HSF, MGI-2, B-cell stimulatory factor 2, Interferon beta-2, Hybridoma growth factor, CTL differentiation factor, CDF, IL-6, HGF.
Reagent Appearance
Sterile filtered colorless solution.
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Amino acid sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Biological Activity
ED50
New