Interleukin-13 Human Recombinant ( IL 13 Human )

Data sheet

Formulation

The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.

Solubility

It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Purity

Greater than 95% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Description

Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.

Protein Background

IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL-13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells.

Expression host

Escherichia Coli.

Synonyms

NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.

Reagent Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Stability

Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended t

Amino acid sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.

Biological Activity

The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be 1 x 106units/mg.