Interleukin-23 Human Recombinant, His Tag ( IL 23 Human, His )

Data sheet

Formulation

IL-23 His Tag protein is supplied in 50mM Tris pH 7.5, 130mM NaCl and 10% Glycerol.

Purity

Greater than 90.0% as determined by analysis by SDS-PAGE.

Description

IL-23 Human Recombinant produced in HEK 293 cells is a heterodimer (IL23A co-transfected with IL12B), containing one polypeptide chain of IL23 protein (19.77kDa) fused with a C-terminal His tag and one polypeptide chain of IL12b-Flag (35.69kDa).The IL-23

Protein Background

IL23 is composed of a subunit of the heterodimeric cytokine IL23 and the p40 subunit of interleukin 12 (IL12B). Interleukin-23 (IL-23) belongs to the IL-12 family and is produced by antigen presenting cells. IL-23 using IL12RB1 and IL-23R (specific for IL

Expression host

HEK 293 cells.

Synonyms

Interleukin 23 alpha subunit p19, Interleukin-12 subunit beta p40, SGRF, IL23P19, IL-23-A, interleukin-six, G-CSF related factor, JKA3 induced upon T-cell activation, interleukin 12B (natural killer cell stimulatory factor 2 cytotoxic lymphocyte maturatio

Reagent Appearance

Sterile Filtered clear solution.

Stability

Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles.

Amino acid sequence

IL23A-His:RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCG DGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLS QLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP HHHHHHHH.IL12B-Flag:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKT