MIG Human Recombinant ( CXCL9 ) ( MIG Human )

Data sheet

Formulation

Lyophilized from a 0.2m filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl.

Solubility

It is recommended to reconstitute the lyophilized MIG in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Purity

Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Description

MIG (monokine induced by gamma-interferon ) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton. The MIG is purified by proprietary chromatographic te

Protein Background

Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by gamma interferon (MIG). CXCL9 is a T-cell chemoattractant, which is induced by IFN-?. It is closely related to two

Expression host

Escherichia Coli.

Synonyms

Small inducible cytokine B9, CXCL9, Gamma interferon-induced monokine, MIG, chemokine (C-X-C motif) ligand 9, CMK, Humig, SCYB9, crg-10, monokine induced by gamma-interferon.

Reagent Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Stability

Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL9 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a c

Amino acid sequence

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT.

Biological Activity

Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.