More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| NME/NM23 nucleoside diphosphate kinase 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | NME1 |
Protein | Nucleoside diphosphate kinase A |
Uniprot ID | P15531 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | AWD antibody|AWD, drosophila, homolog of antibody|GAAD antibody|Granzyme A activated DNase antibody|Granzyme A-activated DNase antibody|GZMA activated DNase antibody|Metastasis inhibition factor NM23 antibody|NB antibody|NBS antibody|NDK A antibody|NDKA antibody| NDKA_HUMAN antibody|NDP kinase A antibody|NDPK-A antibody|NDPKA antibody|NM23 antibody|NM23 long variant, included antibody| nm23-H1 antibody|NM23-M1 antibody|NM23H1B, included antibody|NME/NM23 nucleoside diphosphate kinase 1 antibody|Nme1 antibody|NME1-NME2 spliced read-through transcript, included antibody|Non-metastatic cells 1, protein (NM23A) expressed in antibody| Nonmetastatic cells 1, protein expressed in antibody|Nonmetastatic protein 23 antibody|Nonmetastatic protein 23, homolog 1 antibody| Nucleoside diphosphate kinase A antibody|Tumor metastatic process-associated protein antibody |
Application Details
Anti- NM23A antibody, ASA-B1385, Western blotting
All lanes: Anti NM23A (ASA-B1385) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Liver Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 20KD
Observed bind size: 20KD
All lanes: Anti NM23A (ASA-B1385) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Liver Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 20KD
Observed bind size: 20KD
