More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| monoamine oxidase B | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human MAOB (448-484aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | MAOB |
Protein | Amine oxidase [flavin-containing] B |
Uniprot ID | P21397 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | Adrenalin oxidase antibody|Amine oxidase (flavin containing) antibody|Amine oxidase [flavin-containing] B antibody|AOFB_HUMAN antibody| HGNC:6834 antibody|MAO, brain antibody| MAO, platelet antibody|MAO-B antibody|MAOB antibody|MGC26382 antibody|Monoamine oxidase B antibody|Monoamine oxidase type B antibody|OTTHUMP00000023166 antibody|RP1 201D17__B.1 antibody|Tyramine oxidase antibody |
Application Details
Anti- MAOB antibody, ASA-B1214, Western blotting
All lanes: Anti MAOB (ASA-B1214) at 0.5ug/ml
Lane 1: Rat Cardiac MuscleTissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Rat Intestine Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: Mouse Intestine Tissue Lysate at 50ug
Lane 6: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Lane 8: HELA Whole Cell Lysate at 40ug
Lane
All lanes: Anti MAOB (ASA-B1214) at 0.5ug/ml
Lane 1: Rat Cardiac MuscleTissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Rat Intestine Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: Mouse Intestine Tissue Lysate at 50ug
Lane 6: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Lane 8: HELA Whole Cell Lysate at 40ug
Lane
Anti- MAOB antibody, ASA-B1214,IHC(P)
IHC(P): Mouse Intestine Tissue
IHC(P): Mouse Intestine Tissue
Anti- MAOB antibody, ASA-B1214,IHC(P)
IHC(P): Rat Intestine Tissue
IHC(P): Rat Intestine Tissue