More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP (592-624aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | HSPA5 |
Protein | 78 kDa glucose-regulated protein |
Uniprot ID | P11021 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | 78 kDa glucose regulated protein antibody|78 kDa glucose-regulated protein antibody|AL022860 antibody|AU019543 antibody|BIP antibody| D2Wsu141e antibody|D2Wsu17e antibody| Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78 antibody|Endoplasmic reticulum lumenal Ca2+ binding protein grp78 antibody|FLJ26106 antibody|Glucose Regulated Protein 78kDa antibody|GRP 78 antibody|GRP-78 antibody|GRP78 antibody|GRP78_HUMAN antibody|Heat shock 70 kDa protein 5 antibody|Heat Shock 70kDa Protein 5 antibody|Hsce70 antibody| HSPA 5 antibody|HSPA5 antibody|Immunoglobulin Heavy Chain Binding Protein antibody|Immunoglobulin heavy chain-binding protein antibody|mBiP antibody|MIF2 antibody|Sez7 antibody |
Application Details
Anti- GRP78 BiP antibody, ASA-B0826, Western blotting
All lanes: Anti GRP78 BiP (ASA-B0826) at 0.5ug/ml
WB: HELA Whole Cell Lysate at 40ug
Predicted bind size: 80KD
Observed bind size: 80KD
All lanes: Anti GRP78 BiP (ASA-B0826) at 0.5ug/ml
WB: HELA Whole Cell Lysate at 40ug
Predicted bind size: 80KD
Observed bind size: 80KD
Anti- GRP78 BiP antibody, ASA-B0826, IHC(P)
IHC(P): Mouse Testis Tissue
IHC(P): Mouse Testis Tissue
Anti- GRP78 BiP antibody, ASA-B0826, IHC(P)
IHC(P): Mouse Brain Tissue
IHC(P): Mouse Brain Tissue