ASA-B1802
Warning: Last items in stock!
Availability date:
STAT6 Antibody
Recipient :
* Required fields
or Cancel
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
signal transducer and activator of transcription 6, interleukin-4 induced | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | STAT6 |
Protein | Signal transducer and activator of transcription 6 |
Uniprot ID | P42226 |
Function | Carries out a dual function: signal transduction and activation of transcription. Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling. |
Tissue Specificity | |
Sub-cellular localization | Cytoplasm. Nucleus. Note: Translocated into the nucleus in response to phosphorylation. |
Sequence Similarities | Belongs to the transcription factor STAT family. |
Aliases | D12S1644 antibody|IL 4 STAT antibody|IL-4 Stat antibody|IL4 STAT antibody| Interleukin 4 Induced antibody|Interleukin 4 Induced Transcription Factor IL4 STAT antibody|Signal transducer and activator of transcription 6 antibody|Signal Transducer And Activator Of Transcription 6 Interleukin 4 Induced antibody|Signal Transducer And Activator Of Transcription 6 Nirs Variant 1 antibody|Signal transducer and activator of transcription 6, interleukin 4 induced antibody|STAT 6 antibody|STAT interleukin4 induced antibody|STAT, interleukin4 induced antibody| Stat6 antibody|STAT6_HUMAN antibody|STAT6B antibody|STAT6C antibody| Transcription factor IL 4 STAT antibody |
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Rat Human | AssaySolutio's ECL kit |