ASA-B1771
Warning: Last items in stock!
Availability date:
SPARC Antibody
Recipient :
* Required fields
or Cancel
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
secreted protein, acidic, cysteine-rich (osteonectin) | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the C-terminus of human SPARC (268-303aa RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI), different from the related mouse and rat sequences by four amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | SPARC |
Protein | SPARC |
Uniprot ID | P09486 |
Function | Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
Tissue Specificity | |
Sub-cellular localization | Secreted, extracellular space, extracellular matrix, basement membrane. |
Sequence Similarities | Belongs to the SPARC family. |
Aliases | AA517111 antibody|Basement membrane protein 40 antibody|Basement-membrane protein 40 antibody|BM 40 antibody|BM-40 antibody|BM40 antibody| Cysteine rich protein antibody| hm:zeh0062 antibody|MGC128090 antibody|ON antibody|Osteonectin antibody|Secreted acidic cystein rich glycoprotein antibody| Secreted protein acidic and rich in cysteine antibody| Secreted protein acidic cysteine rich (osteonectin) antibody|Secreted protein acidic cysteine rich antibody| SPARC antibody|SPRC antibody|SPRC_HUMAN antibody |
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |