More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| secreted protein, acidic, cysteine-rich (osteonectin) | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the C-terminus of human SPARC (268-303aa RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI), different from the related mouse and rat sequences by four amino acids. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | SPARC |
Protein | SPARC |
Uniprot ID | P09486 |
Function | Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
Tissue Specificity | |
Sub-cellular localization | Secreted, extracellular space, extracellular matrix, basement membrane. |
Sequence Similarities | Belongs to the SPARC family. |
Aliases | AA517111 antibody|Basement membrane protein 40 antibody|Basement-membrane protein 40 antibody|BM 40 antibody|BM-40 antibody|BM40 antibody| Cysteine rich protein antibody| hm:zeh0062 antibody|MGC128090 antibody|ON antibody|Osteonectin antibody|Secreted acidic cystein rich glycoprotein antibody| Secreted protein acidic and rich in cysteine antibody| Secreted protein acidic cysteine rich (osteonectin) antibody|Secreted protein acidic cysteine rich antibody| SPARC antibody|SPRC antibody|SPRC_HUMAN antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- SPARC antibody, ASA-B1771, Western blotting
All lanes: Anti SPARC (ASA-B1771) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: 293T Whole Cell Lysate at 40ug
Lane 3: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 35KD
Observed bind size: 35KD