More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
Sp2 transcription factor | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human SP2 (312-343aa QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ), identical to the related mouse sequence. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | SP2 |
Protein | Transcription factor Sp2 |
Uniprot ID | Q02086 |
Function | Binds to GC box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites. |
Tissue Specificity | |
Sub-cellular localization | Nucleus. |
Sequence Similarities | Belongs to the Sp1 C2H2-type zinc-finger protein family. |
Aliases | Kiaa0048 antibody|OTTHUMP00000196580 antibody|SP2 antibody|SP2_HUMAN antibody|SPECIFICITY PROTEIN 2 antibody|Transcription factor Sp2 antibody |
Application Details
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- SP2 antibody, ASA-B1766, Western blotting
All lanes: Anti SP2 (ASA-B1766) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: A549 Whole Cell Lysate at 40ug
Lane 3: HELA Whole Cell Lysate at 40ug
Predicted bind size: 72KD
Observed bind size: 72KD