More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| SRY (sex determining region Y)-box 5 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | SOX5 |
Protein | Transcription factor SOX-5 |
Uniprot ID | P35711 |
Function | Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of COL2A1 and AGC1 in vitro. |
Tissue Specificity | |
Sub-cellular localization | Nucleus. |
Sequence Similarities | Contains 1 HMG box DNA-binding domain. |
Aliases | L SOX5 antibody|MGC35153 antibody|Sex determining region Y box 5 antibody| SOX 5 antibody| SOX 5 protein antibody|Sox5 antibody|SOX5 protein antibody| SOX5_HUMAN antibody|SRY (sex determining region Y) box 5 antibody|SRY box 5 antibody|Transcription factor SOX 5 antibody|Transcription factor SOX-5 antibody| Transcription factor SOX5 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- SOX5 antibody, PBSOX5, Western blotting
All lanes: Anti SOX5 (ASA-B1761) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Testis Tissue Lysate at 50ug
Lane 3: Rat Brain Tissue Lysate at 50ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: A549 Whole Cell Lysate at 40ug
Predicted bind size: 84KD
Observed bind size: 84KD