ASA-B1725
Warning: Last items in stock!
Availability date:
SMAD1/2/3/4/5 Antibody
Recipient :
* Required fields
or Cancel
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
SMAD family member 1/2/3/4/5 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence in the middle region of human SMAD1/2/3/4/5 (240-270aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | SMAD1/2/3/4/5 |
Protein | Mothers against decapentaplegic homolog 1/2/3/4/5 |
Uniprot ID | Q15797 |
Function | Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD1 is a receptor-regulated SMAD (R-SMAD). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. May act synergistically with SMAD4 and YY1 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression. |
Tissue Specificity | Ubiquitous. Highest expression seen in the heart and skeletal muscle. |
Sub-cellular localization | Cytoplasm. Nucleus. Note: Cytoplasmic in the absence of ligand. Migrates to the nucleus when complexed with SMAD4. Co-localizes with LEMD3 at the nucleus inner membrane. |
Sequence Similarities | Belongs to the dwarfin/SMAD family. |
Aliases | BSP 1 antibody|DwfA antibody|hSMAD1 antibody|JV41 antibody|MAD homolog 1 antibody|Mad-related protein 1 antibody|Smad1 antibody|hMAD 2 antibody|JV18 antibody|MAD homolog 2 antibody|SMAD 2 antibody|hMAD 3 antibody|JV15 2 antibody|MAD3 antibody|SMAD 3 antibody|hSMAD4 antibody|MADH 4 antibody|SMAD4 antibody|JV5 1 antibody|Dwfc antibody|SMAD 5 antibody |
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |