Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| secreted and transmembrane 1 | Polyclonal | IgG | Rabbit | Mouse | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK). | ||||||
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | SECTM1 |
Protein | Secreted and transmembrane protein 1b |
Uniprot ID | Q9JL59 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | K12 antibody|K12 protein antibody|Protein K-12 antibody|Protein K12 antibody|SCTM1_HUMAN antibody|Secreted and transmembrane 1 antibody|Secreted and transmembrane protein 1 antibody|SECTM 1 antibody|SECTM1 antibody|Type 1a transmembrane protein antibody |

