More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| scavenger receptor class B, member 1 | Polyclonal | IgG | Rabbit | Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | SCARB1 |
Protein | Scavenger receptor class B member 1 |
Uniprot ID | Q61009 |
Function | Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity (By similarity). Plays an important role in the uptake of HDL cholesteryl ester (By similarity). |
Tissue Specificity | Expressed primarily in liver and non-placental steroidogenic tissues. |
Sub-cellular localization | Cell membrane ; Multi-pass membrane protein . Membrane, caveola ; Multi-pass membrane protein . Note: Predominantly localized to cholesterol and sphingomyelin-enriched domains within the plasma membrane, called caveolae. |
Sequence Similarities | |
Aliases | CD36 AND LIMPII ANALOGOUS 1 antibody|CD36 antibody|CD36 Antigen like 1 antibody|CD36 antigen-like 1 antibody|CD36L1 antibody|CLA 1 antibody|CLA-1 antibody|CLA1 antibody| Collagen type I receptor antibody|HDLQTL6 antibody| MGC138242 antibody|SCARB1 antibody| Scavebger Receptor Class B Member 1 antibody|Scavenger receptor class B member 1 antibody| Scavenger Receptor Class B Type 1 antibody|SCRB1_HUMAN antibody|SR BI antibody|SR-BI antibody| SRB1 antibody|SRBI antibody|Thrombospondin receptor like 1 antibody| thrombospondin receptor-like 1 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Mouse, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti-SCARB1 antibody, ASA-B1650, Western blotting
All lanes: Anti SCARB1 (ASA-B1650) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Predicted bind size: 57KD
Observed bind size: 57KD
All lanes: Anti SCARB1 (ASA-B1650) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Predicted bind size: 57KD
Observed bind size: 57KD
