RUNX2  Antibody View larger

RUNX2 Antibody

ASA-B1640

$386.90

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

runt-related transcription factor 2 Polyclonal IgG Rabbit Human WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

RUNX2

Protein

Runt-related transcription factor 2

Uniprot ID

Q13950

Function

Transcription factor involved in osteoblastic differentiation and skeletal morphogenesis. Essential for the maturation of osteoblasts and both intramembranous and endochondral ossification. CBF binds to the core site, 5'- PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, osteocalcin, osteopontin, bone sialoprotein, alpha 1(I) collagen, LCK, IL-3 and GM-CSF promoters. In osteoblasts, supports transcription activation: synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE) (By similarity). Inhibits KAT6B-dependent transcriptional activation.

Tissue Specificity

Specifically expressed in osteoblasts.

Sub-cellular localization

Nucleus.

Sequence Similarities

Contains 1 Runt domain.

Aliases

Acute myeloid leukemia 3 protein antibody|Alpha subunit 1 antibody|AML3 antibody|CBF alpha 1 antibody|CBF-alpha-1 antibody|CBFA1 antibody|CCD antibody|CCD1 antibody|Cleidocranial dysplasia 1 antibody|Core binding factor antibody|Core binding factor runt domain alpha subunit 1 antibody|Core binding factor subunit alpha 1 antibody|Core-binding factor subunit alpha-1 antibody|MGC120022 antibody|MGC120023 antibody|Oncogene AML 3 antibody|Oncogene AML-3 antibody|OSF 2 antibody|OSF-2 antibody|OSF2 antibody|Osteoblast specific transcription factor 2 antibody|Osteoblast-specific transcription factor 2 antibody|OTTHUMP00000016533 antibody|PEA2 alpha A antibody|PEA2-alpha A antibody|PEA2aA antibody|PEBP2 alpha A antibody|PEBP2-alpha A antibody|PEBP2A1 antibody|PEBP2A2 antibody|PEBP2aA antibody|PEBP2aA antibody|PEBP2aA1 antibody|Polyomavirus enhancer binding protein 2 alpha A subunit antibody|Polyomavirus enhancer-binding protein 2 alpha A subunit antibody|Runt domain antibody|Runt related transcription factor 2 antibody|Runt-related transcription factor 2 antibody|RUNX2 antibody|RUNX2_HUMAN antibody|SL3 3 enhancer factor 1 alpha A subunit antibody|SL3-3 enhancer factor 1 alpha A subunit antibody|SL3/AKV core binding factor alpha A subunit antibody|SL3/AKV core-binding factor alpha A subunit antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml HumanAssaySolutio's ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti-RUNX2 antibody, ASA-B1640--1.jpg
All lanes: Anti RUNX2 (ASA-B1640) at 0.5ug/ml
WB: Recombinant Human RUNX2 Protein 0.5ng
Predicted bind size: 50KD
Observed bind size: 50KD
Anti-RUNX2 antibody, ASA-B1640--2.jpg
All lanes: Anti RUNX2 (ASA-B1640) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: A431 Whole Cell Lysate at 40ug
Lane 3: K562 Whole Cell Lysate at 40ug
Lane 4: JURKAT Whole Cell Lysate at 40ug
Predicted bind size: 56KD
Observed bind size: 62KD

© 2024 Novateinbio.com