More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| phospholamban | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the N-terminus of human PLN(1-35aa MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF), different from the related mouse and rat sequences by one amino acid. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | PLN |
Protein | Cardiac phospholamban |
Uniprot ID | P26678 |
Function | Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation. |
Tissue Specificity | Heart muscle (at protein level). |
Sub-cellular localization | Sarcoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane ; Single- pass membrane protein . Endoplasmic reticulum membrane; Single-pass membrane protein. |
Sequence Similarities | |
Aliases | Cardiac phospholamban antibody|CMD1P antibody|CMH18 antibody|PLB antibody|PLN antibody|PPLA_HUMAN antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- PLN antibody, ASA-B1547, Western blotting
All lanes: Anti PLN (ASA-B1547) at 0.5ug/ml
Lane 1: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: COLO320 Whole Cell Lysate at 40ug
Lane 4: K562 Whole Cell Lysate at 40ug
Predicted bind size: 6KD
Observed bind size: 18, 24, 36KD