More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| orthodenticle homeobox 2 | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | OTX2 |
Protein | Homeobox protein OTX2 |
Uniprot ID | P32243 |
Function | Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'. |
Tissue Specificity | Expressed in brain. |
Sub-cellular localization | Nucleus . |
Sequence Similarities | Belongs to the paired homeobox family. Bicoid subfamily. |
Aliases | CPHD6 antibody|Homeobox protein OTX2 antibody|MCOPS 5 antibody|MCOPS5 antibody|MGC45000 antibody|Orthodenticle 2 antibody|Orthodenticle homeobox 2 antibody|Orthodenticle homolog 2 (Drosophila) antibody|Orthodenticle homolog 2 antibody|Orthodenticle2 antibody|Otx 2 antibody|otx2 antibody|OTX2_HUMAN antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Otx2 antibody, ASA-B1443, Western blotting
All lanes: Anti Otx2 (ASA-B1443) at 0.5ug/ml
WB: COLO320 Whole Cell Lysate at 40ug
Predicted bind size: 32KD
Observed bind size: 32KD