More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
secreted phosphoprotein 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | ELISA, WB | Immunogen affinity purified. |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | SPP1 |
Protein | Osteopontin |
Uniprot ID | P10451 |
Function | Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. |
Tissue Specificity | Bone. Found in plasma. |
Sub-cellular localization | Secreted. |
Sequence Similarities | Belongs to the osteopontin family. |
Aliases | BNSP antibody|Bone sialoprotein 1 antibody|BSP I antibody|BSPI antibody|Early T lymphocyte activation 1 antibody|ETA 1 antibody|ETA1 antibody|MGC110940 antibody|Nephropontin antibody|OPN antibody|Osteopontin antibody| osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein antibody|OSTP_HUMAN antibody|PSEC0156 antibody|secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1) antibody| Secreted phosphoprotein 1 antibody|SPP 1 antibody|SPP-1 antibody|SPP1 antibody|SPP1/CALPHA1 fusion antibody|Urinary stone protein antibody| Uropontin antibody |
Application Details
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |
ELISA | 0.1-0.5μg/ml | Human | Sandwich ELISA format |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Osteopontin antibody, ASA-B1440, Western blotting
All lanes: Anti Osteopontin (ASA-B1440) at 0.5ug/ml
Lane 1: Mouse Pancreas Tissue Lysate at 50ug
Lane 2: JURKAT Whole Cell Lysate at 40ug
Lane 3: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 66KD
Observed bind size: 66KD