More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| matrix metallopeptidase 3 (stromelysin 1, progelatinase) | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | MMP3 |
Protein | Stromelysin-1 |
Uniprot ID | P08254 |
Function | Can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. Activates procollagenase. |
Tissue Specificity | |
Sub-cellular localization | Secreted, extracellular space, extracellular matrix . |
Sequence Similarities | Belongs to the peptidase M10A family. |
Aliases | CHDS6 antibody|Matrix metalloproteinase 3 antibody|Matrix metalloproteinase 3 preproprotein antibody|Matrix metalloproteinase-3 antibody|MGC126102 antibody|MGC126103 antibody|MGC126104 antibody|MMP 3 antibody|MMP-3 antibody|MMP3 antibody|MMP3_HUMAN antibody|Progelatinase antibody|Proteoglycanase antibody|SL 1 antibody|SL-1 antibody|SL1 antibody|STMY antibody|STMY1 antibody|STR1 antibody|Stromelisin 1 antibody|Stromelysin 1 antibody|Stromelysin 1 progelatinase antibody|Stromelysin-1 antibody|Transin 1 antibody|Transin-1 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- MMP3 antibody, ASA-B1292, Western blotting
All lanes: Anti MMP3 (ASA-B1292) at 0.5ug/ml
WB: Recombinant Human MMP3 Protein 0.5ng
Predicted bind size: 36KD
Observed bind size: 36KD
Anti- MMP3 antibody, ASA-B1292, Western blotting
All lanes: Anti MMP3 (ASA-B1292) at 0.5ug/ml
Lane 1: Human Placenta Tissue Lysate at 50ug
Lane 2: U20S Whole Cell Lysate at 40ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: PANC Whole Cell Lysate at 40ug
Lane 5: COLO320 Whole Cell Lysate at 40ug
Predicted bind size: 54KD
Observed bind size: 54KD