Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| matrix metallopeptidase 12 (macrophage elastase) | Polyclonal | IgG | Rabbit | Mouse | ELISA, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids. | ||||||
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | MMP12 |
Protein | Macrophage metalloelastase |
Uniprot ID | P34960 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | EC 3.4.24.65 antibody|HME antibody|Macrophage elastase antibody|Macrophage metalloelastase antibody|Macrophage metaloelastase antibody|Matrix metallopeptidase 12 (macrophage elastase) antibody|Matrix metalloprotease 12 antibody|Matrix metalloproteinase-12 antibody| ME antibody|MGC138506 antibody|MME antibody|MMP 12 antibody|MMP-12 antibody|Mmp12 antibody|MMP12_HUMAN antibody |

