More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| matrix metallopeptidase 10 (stromelysin 2) | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human MMP10 (409-443aa RFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAF), different from the related mouse sequence by twelve amino acids, and from the related rat sequence by nine amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | MMP10 |
Protein | Stromelysin-2 |
Uniprot ID | P09238 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | Matrix metallopeptidase 10 (stromelysin 2) antibody|Matrix metalloprotease 10 antibody|Matrix metalloproteinase 10 (stromelysin 2) antibody| Matrix metalloproteinase 10 antibody|Matrix metalloproteinase-10 antibody|MMP 10 antibody|MMP-10 antibody|Mmp10 antibody| MMP10_HUMAN antibody|SL 2 antibody|SL-2 antibody|SL2 antibody|STMY 2 antibody|STMY2 antibody|Stromelysin 2 antibody|Stromelysin II antibody|Stromelysin-2 antibody|Stromelysin2 antibody|StromelysinII antibody|Transin 2 antibody|Transin-2 antibody|Transin2 antibody |
Application Details
Anti- MMP10 antibody, ASA-B1284, Western blotting
All lanes: Anti MMP10 (ASA-B1284) at 0.5ug/ml
Lane 1: Human Placenta Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: SGC Whole Cell Lysate at 40ug
Predicted bind size: 54KD
Observed bind size: 54KD
All lanes: Anti MMP10 (ASA-B1284) at 0.5ug/ml
Lane 1: Human Placenta Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: SGC Whole Cell Lysate at 40ug
Predicted bind size: 54KD
Observed bind size: 54KD
