More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| MHC class I polypeptide-related sequence A | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the C-terminus of human MICA (304-334aa QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK). |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | MICA |
Protein | MHC class I polypeptide-related sequence A |
Uniprot ID | Q29983 |
Function | Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T- cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis. |
Tissue Specificity | Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's corpuscles within the medulla of normal thymus. In skin, expressed mainly in the keratin layers, basal cells, ducts and follicles. Also expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. In thyomas, overexpressed in cortical and medullar epithelial cells. Tumors expressing MICA display increased levels of gamma delta T-cells. |
Sub-cellular localization | Cell membrane. |
Sequence Similarities | Belongs to the MHC class I family. MIC subfamily. |
Aliases | HLA class I antigen antibody|FLJ36918 antibody|FLJ60820 antibody|MGC111087 antibody|MGC21250 antibody|MHC class I chain related gene A protein antibody|MHC class I chain related protein A antibody|MHC class I chain related protein A HLA B HLA C antibody|MHC class I polypeptide related sequence A antibody|MHC class I polypeptide-related sequence A antibody|MHC class I related protein antibody|MIC A antibody|MIC-A antibody|micA antibody|MICA_HUMAN antibody|OTTHUMP00000029088 antibody|OTTHUMP00000044528 antibody| OTTHUMP00000165170 antibody|OTTHUMP00000165172 antibody|PERB11.1 antibody|Stress inducible class I homolog antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- MICA antibody, ASA-B1271, Western blotting
All lanes: Anti MICA (ASA-B1271) at 0.5ug/ml
Lane 1: SW620Whole Cell Lysate at 40ug
Lane 2: A549 Whole Cell Lysate at 40ug
Lane 3: MCF-7 Whole Cell Lysate at 40ug
Lane 4: HELA Whole Cell Lysate at 40ug
Predicted bind size: 43KD
Observed bind size: 43KD