Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
leptin | Polyclonal | IgG | Rabbit | Mouse | ELISA, WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence in the middle region of mouse Leptin (74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH), different from the related human sequence by five amino acids, and from the related rat sequence by two amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | LEP |
Protein | Leptin |
Uniprot ID | P41160 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | FLJ94114 antibody|LEP antibody|LEP_HUMAN antibody|LEPD antibody|Leptin (murine obesity homolog) antibody|Leptin (obesity homolog, mouse) antibody|Leptin antibody|Leptin Murine Obesity Homolog antibody|Leptin Precursor Obesity Factor antibody|OB antibody|Obese Protein antibody|Obese, mouse, homolog of antibody|Obesity antibody|Obesity factor antibody|Obesity factor antibody|Obesity homolog mouse antibody|Obesity Murine Homolog Leptin antibody|OBS antibody|OTTHUMP00000212285 antibody |