Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| potassium channel, voltage gated shaker related subfamily A, member 2 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV), identical to the related mouse and rat sequences. | ||||||
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | KCNA2 |
Protein | Potassium voltage-gated channel subfamily A member 2 |
Uniprot ID | P16389 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | Akr6a4 antibody|BK2 antibody|HBK5 antibody|HK4 antibody|HUKIV antibody|Kca1 2 antibody|kcna2 antibody|KV1.2 antibody|MGC50217 antibody|Mk 2 antibody|MK2 antibody|NGK1 antibody|Potassium voltage gated channel shaker related subfamily member 2 antibody|Potassium voltage-gated channel subfamily A member 2 antibody|RBK2 antibody|Voltage gated potassium channel subunit Kv1.2 antibody |

