ASA-B0786
Warning: Last items in stock!
Availability date:
GJA3 Antibody
Recipient :
* Required fields
or Cancel
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
gap junction protein, alpha 3, 46kDa | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | GJA3 |
Protein | Gap junction alpha-3 protein |
Uniprot ID | Q9Y6H8 |
Function | One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. |
Tissue Specificity | |
Sub-cellular localization | Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. |
Sequence Similarities | |
Aliases | CAE3 antibody|Connexin 46 antibody|Connexin-46 antibody|Connexin46 antibody|Cx46 antibody|CXA3_HUMAN antibody|CZP3 antibody|Gap junction alpha 3 protein antibody|Gap junction alpha-3 protein antibody|Gap junction protein, alpha 3, 46kD (connexin 46) antibody|Gap junction protein, alpha 3, 46kDa (connexin 46) antibody|Gap junction protein, alpha 3, 46kDa antibody|Gja3 antibody |
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |