Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
lectin, galactoside-binding, soluble, 9 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the C-terminus of human galectin 9 (322-355aa DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | LGALS9 |
Protein | Galectin-9 |
Uniprot ID | O00182 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | Ecalectin antibody|Gal-9 antibody|Galectin-9 antibody|galectin9 antibody|HOM HD 21 antibody|HOMHD21 antibody|HUAT antibody|Lectin galactoside binding soluble 9 antibody|LEG9_HUMAN antibody|LGAL S9 antibody|LGALS 9 antibody|Lgals9 antibody|LGALS9A antibody| MGC117375 antibody|MGC125973 antibody|MGC125974 antibody|Tumor antigen HOM-HD-21 antibody|Urate transporter/channel protein antibody |