Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
lectin, galactoside-binding, soluble, 8 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | LGALS8 |
Protein | Galectin-8 |
Uniprot ID | O00214 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | Gal 8 antibody|Gal-8 antibody|Gal8 antibody|Galectin-8 antibody|galectin-8g antibody|Lectin galactoside binding soluble 8 antibody| LEG8_HUMAN antibody|LGAL S8 antibody|Lgals8 antibody|PCTA 1 antibody|PCTA-1 antibody|PCTA1 antibody|Po66 carbohydrate binding protein antibody|Po66 carbohydrate-binding protein antibody|Po66 CBP antibody|Po66-CBP antibody|Prostate carcinoma tumor antigen 1 antibody |