More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| flavin containing monooxygenase 3 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human FMO3 (404-433aa DMMNDINEKMEKKRKWFGKSETIQTDYIVY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | FMO3 |
Protein | Dimethylaniline monooxygenase [N-oxide-forming] 3 |
Uniprot ID | P31513 |
Function | Involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. Plays an important role in the metabolism of trimethylamine (TMA), via the production of TMA N-oxide (TMAO). Is also able to perform S-oxidation when acting on sulfide compounds (PubMed:9224773). |
Tissue Specificity | Liver. |
Sub-cellular localization | Microsome membrane. Endoplasmic reticulum membrane. |
Sequence Similarities | Belongs to the FMO family. |
Aliases | Dimethylaniline monooxygenase [N oxide forming] 3 antibody|Dimethylaniline monooxygenase [N-oxide-forming] 3 antibody|Dimethylaniline monooxygenase 3 antibody|Dimethylaniline oxidase 3 antibody|dJ127D3.1 antibody|Flavin containing monooxygenase 3 antibody|FMO 3 antibody|FMO form 2 antibody|FMO II antibody|FMO3 antibody|FMO3_HUMAN antibody|FMOII antibody|Hepatic flavin containing monooxygenase 3 antibody|Hepatic flavin-containing monooxygenase 3 antibody|MGC34400 antibody|TMAU antibody|Trimethylamine monooxygenase antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- FMO3 antibody, ASA-B0724, Western blotting
All lanes: Anti FMO3 (ASA-B0724) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 60KD
Observed bind size: 60KD
All lanes: Anti FMO3 (ASA-B0724) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 60KD
Observed bind size: 60KD
