More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| fms-related tyrosine kinase 3 ligand | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human Flt3 ligand (79-110aa AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK), different from the related mouse sequence by four amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | FLT3LG |
Protein | Fms-related tyrosine kinase 3 ligand |
Uniprot ID | P49771 |
Function | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. |
Tissue Specificity | |
Sub-cellular localization | Isoform 1: Cell membrane; Single-pass type I membrane protein. |
Sequence Similarities | |
Aliases | Flt 3 ligand antibody|Flt 3L antibody|Flt3 L antibody|FLT3 LG antibody|Flt3 ligand antibody|Flt3L antibody|FLT3L_HUMAN antibody|FLT3LG antibody|Fms related tyrosine kinase 3 ligand antibody|Fms-related tyrosine kinase 3 ligand antibody|SL cytokine antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Flt3 ligand antibody, ASA-B1182, Western blotting
All lanes: Anti Flt3 ligand (ASA-B1182) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Spleen Tissue Lysate at 50ug
Lane 3: Rat Kidney Tissue Lysate at 50ug
Lane 4: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 26KD
Observed bind size: 26KD
All lanes: Anti Flt3 ligand (ASA-B1182) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Spleen Tissue Lysate at 50ug
Lane 3: Rat Kidney Tissue Lysate at 50ug
Lane 4: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 26KD
Observed bind size: 26KD
