More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| gap junction protein, gamma 1, 45kDa | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Connexin 45/GJA7 (333-363aa ADLEALQREIRMAQERLDLAVQAYSHQNNP H), different from the related mouse and rat sequences by three amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | GJC1 |
Protein | Gap junction gamma-1 protein |
Uniprot ID | P36383 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | Connexin 45 antibody|Connexin-45 antibody|Connexin45 antibody|CX 31.9 antibody|CX 45 antibody|CX31.9 antibody|Cx45 antibody| CXG1_ HUMAN antibody|DKFZp686P0738 antibody|Gap junction alpha 7 protein antibody|Gap junction alpha-7 protein antibody|Gap junction gamma 1 protein antibody|Gap junction gamma-1 protein antibody|Gap junction protein alpha 7 45kDa antibody|Gap junction protein alpha 7 antibody| Gap junction protein, gamma 1, 45kDa antibody|GJA 7 antibody|GJA7 antibody|GJC1 antibody|GJD3 antibody |
Application Details
Anti- Connexin 45/GJA7 antibody, ASA-B0487, Western blotting
All lanes: Anti Connexin 45/GJA7 (ASA-B0487)0.5ug/ml
Lane 1: Rat Gaster Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: PANC Whole Cell Lysate at 40ug
Predicted bind size: 45KD
Observed bind size: 45KD
All lanes: Anti Connexin 45/GJA7 (ASA-B0487)0.5ug/ml
Lane 1: Rat Gaster Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: PANC Whole Cell Lysate at 40ug
Predicted bind size: 45KD
Observed bind size: 45KD
