More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| cyclin-dependent kinase 5, regulatory subunit 1 (p35) | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the N-terminus of human CDK5R1 (11-44aa YRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRH), identical to the related mouse and rat sequences. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | CDK5R1 |
Protein | Cyclin-dependent kinase 5 activator 1 |
Uniprot ID | Q15078 |
Function | p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution. |
Tissue Specificity | Brain and neuron specific. |
Sub-cellular localization | Cyclin-dependent kinase 5 activator 1, p35: Cell membrane ; Lipid-anchor ; Cytoplasmic side . Note: In the primary cortical neurons, p35 is present in the peripheries and nerve terminals. |
Sequence Similarities | Belongs to the cyclin-dependent kinase 5 activator family. |
Aliases | CD5R1_HUMAN antibody|CDK 5R1 antibody|CDK5 activator 1 antibody|CDK5P35 antibody|CDK5R antibody|CDK5R1 antibody|Cyclin dependent kinase 5 activator 1 antibody|Cyclin dependent kinase 5 regulatory subunit 1 antibody|Cyclin-dependent kinase 5 activator 1 antibody|Cyclin-dependent kinase 5 regulatory subunit 1 antibody|MGC33831 antibody|NCK 5A antibody|NCK5A antibody|Neuronal CDK5 activator antibody|p23 antibody|p25 antibody|p25 included antibody|p35 antibody|p35nck5a antibody|Regulatory partner for CDK5 kinase antibody|Tau protein kinase II 23 kDa subunit antibody|Tau protein kinase II 23kDa subunit antibody|TPKII regulatory subunit antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- CDK5R1 antibody, (ASA-B0435, Western blotting
All lanes: Anti CDK5R1 (ASA-B0435) at 0.5ug/ml
Lane 1: Human Placenta Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: MCF-7 Whole Cell Lysate at 40ug
Lane 4: U87 Whole Cell Lysate at 40ug
Predicted bind size: 34KD
Observed bind size: 34KD