CDK5R1 Antibody View larger

CDK5R1 Antibody

ASA-B0435

$349.80

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

cyclin-dependent kinase 5, regulatory subunit 1 (p35) Polyclonal IgG Rabbit Human WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human CDK5R1 (11-44aa YRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRH), identical to the related mouse and rat sequences.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

CDK5R1

Protein

Cyclin-dependent kinase 5 activator 1

Uniprot ID

Q15078

Function

p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution.

Tissue Specificity

Brain and neuron specific.

Sub-cellular localization

Cyclin-dependent kinase 5 activator 1, p35: Cell membrane ; Lipid-anchor ; Cytoplasmic side . Note: In the primary cortical neurons, p35 is present in the peripheries and nerve terminals.

Sequence Similarities

Belongs to the cyclin-dependent kinase 5 activator family.

Aliases

CD5R1_HUMAN antibody|CDK 5R1 antibody|CDK5 activator 1 antibody|CDK5P35 antibody|CDK5R antibody|CDK5R1 antibody|Cyclin dependent kinase 5 activator 1 antibody|Cyclin dependent kinase 5 regulatory subunit 1 antibody|Cyclin-dependent kinase 5 activator 1 antibody|Cyclin-dependent kinase 5 regulatory subunit 1 antibody|MGC33831 antibody|NCK 5A antibody|NCK5A antibody|Neuronal CDK5 activator antibody|p23 antibody|p25 antibody|p25 included antibody|p35 antibody|p35nck5a antibody|Regulatory partner for CDK5 kinase antibody|Tau protein kinase II 23 kDa subunit antibody|Tau protein kinase II 23kDa subunit antibody|TPKII regulatory subunit antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml HumanAssaySolutio's ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- CDK5R1 antibody, (ASA-B0435, Western blotting
All lanes: Anti CDK5R1 (ASA-B0435) at 0.5ug/ml
Lane 1: Human Placenta Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: MCF-7 Whole Cell Lysate at 40ug
Lane 4: U87 Whole Cell Lysate at 40ug
Predicted bind size: 34KD
Observed bind size: 34KD

© 2024 Novateinbio.com